Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBE3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154950
Description
UBE3B Polyclonal specifically detects UBE3B in Human samples. It is validated for Western Blot.Specifications
UBE3B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp586K2123, DKFZp686A1051, EC 6.3.2, EC 6.3.2.-, FLJ45294, MGC131858, MGC78388, ubiquitin protein ligase E3B, ubiquitin-protein ligase E3B | |
Rabbit | |
123 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q7Z3V4 | |
UBE3B | |
Synthetic peptides corresponding to UBE3B(ubiquitin protein ligase E3B) The peptide sequence was selected from the middle region of UBE3B. Peptide sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE. | |
Affinity purified | |
RUO | |
89910 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction