UBE3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154950

Catalog No. NBP154950

Description

UBE3B Polyclonal specifically detects UBE3B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UBE3B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp586K2123, DKFZp686A1051, EC 6.3.2, EC 6.3.2.-, FLJ45294, MGC131858, MGC78388, ubiquitin protein ligase E3B, ubiquitin-protein ligase E3B
• Host Species: Rabbit
• Molecular Weight of Antigen: 123 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7Z3V4
• Gene Symbols: UBE3B
• Immunogen: Synthetic peptides corresponding to UBE3B(ubiquitin protein ligase E3B) The peptide sequence was selected from the middle region of UBE3B. Peptide sequence VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 89910
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only