Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP190307

Ubiquitin-activating Enzyme/UBE1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP190307 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP190307 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP190307 Supplier Novus Biologicals Supplier No. NBP190307
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Ubiquitin-activating Enzyme/UBE1 Polyclonal specifically detects Ubiquitin-activating Enzyme/UBE1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Ubiquitin-activating Enzyme/UBE1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias A1S9T, A1S9T and BN75 temperature sensitivity complementing, A1ST, AMCX1, GXP1, MGC4781, POC20, POC20 centriolar protein homolog, Protein A1S9, SMAX2, UBA1, ubiquitin-activating enzyme E1 homolog A, UBA1A, UBE1A1S9, UBE1X, Ubiquitin-activating enzyme E1, ubiquitin-activating enzyme E1 (A1S9T and BN75 temperature sensitivitycomplementing), ubiquitin-like modifier activating enzyme 1, ubiquitin-like modifier-activating enzyme 1
Gene Symbols UBA1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cell Cycle and Replication, Chromatin Research, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 7317
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.