Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ubiquitin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25839825UL
Description
Ubiquitin Polyclonal specifically detects Ubiquitin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Ubiquitin | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
RPS27A, UBA52, UBB ubiquitin B, UBC | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
RPS27A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED | |
25 μL | |
Alzheimers Research, Autophagy, Cancer, Membrane Trafficking and Chaperones, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Protein Turnover, Ubiquitin Proteasome Pathway | |
6233 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction