Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBL7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | UBL7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
UBL7 Polyclonal specifically detects UBL7 in Human samples. It is validated for Western Blot.Specifications
UBL7 | |
Polyclonal | |
Rabbit | |
NP_116296 | |
84993 | |
Synthetic peptide directed towards the N terminal of human UBL7The immunogen for this antibody is UBL7. Peptide sequence LQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BMSCUBP, BMSC-UbPTCBA1, Bone marrow stromal cell ubiquitin-like protein, MGC14421, ubiquitin-like 7 (bone marrow stromal cell-derived), ubiquitin-like protein 7, Ubiquitin-like protein SB132 | |
UBL7 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title