Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBL7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | UBL7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179757
|
Novus Biologicals
NBP179757 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
UBL7 Polyclonal specifically detects UBL7 in Human samples. It is validated for Western Blot.Specifications
| UBL7 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| BMSCUBP, BMSC-UbPTCBA1, Bone marrow stromal cell ubiquitin-like protein, MGC14421, ubiquitin-like 7 (bone marrow stromal cell-derived), ubiquitin-like protein 7, Ubiquitin-like protein SB132 | |
| UBL7 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_116296 | |
| 84993 | |
| Synthetic peptide directed towards the N terminal of human UBL7The immunogen for this antibody is UBL7. Peptide sequence LQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title