Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBR5/EDD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | UBR5/EDD |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
UBR5/EDD Polyclonal specifically detects UBR5/EDD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
UBR5/EDD | |
Polyclonal | |
Rabbit | |
DNA Repair | |
DD5, E3 ubiquitin protein ligase, HECT domain containing, 1, E3 ubiquitin-protein ligase, HECT domain-containing 1, EC 6.3.2, EC 6.3.2.-, EDD1E3 ubiquitin-protein ligase UBR5, EDDE3 identified by differential display, hHYD, HYDFLJ11310, Hyperplastic discs protein homolog, KIAA0896MGC57263, progestin induced protein, Progestin-induced protein, ubiquitin protein ligase E3 component n-recognin 5, ubiquitin-protein ligase | |
UBR5 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
51366 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title