Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBR7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | UBR7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
UBR7 Polyclonal specifically detects UBR7 in Human samples. It is validated for Western Blot.Specifications
UBR7 | |
Polyclonal | |
Rabbit | |
Q8N806 | |
55148 | |
Synthetic peptides corresponding to C14ORF130 The peptide sequence was selected from the N terminal of C14ORF130. Peptide sequence MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C14orf130, chromosome 14 open reading frame 130, EC 6.3.2.-, FLJ10483, MGC9518, N-recognin-7, putative E3 ubiquitin-protein ligase UBR7, ubiquitin protein ligase E3 component n-recognin 7 (putative) | |
UBR7 | |
IgG | |
48 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title