Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBR7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen UBR7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154339
View Documents
Novus Biologicals
NBP154339
100 μL
Each for $436.00
Add to cart
 
NBP15433920
View Documents
Novus Biologicals
NBP15433920UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

UBR7 Polyclonal specifically detects UBR7 in Human samples. It is validated for Western Blot.
Specifications

Specifications

UBR7
Polyclonal
Rabbit
Q8N806
55148
Synthetic peptides corresponding to C14ORF130 The peptide sequence was selected from the N terminal of C14ORF130. Peptide sequence MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
C14orf130, chromosome 14 open reading frame 130, EC 6.3.2.-, FLJ10483, MGC9518, N-recognin-7, putative E3 ubiquitin-protein ligase UBR7, ubiquitin protein ligase E3 component n-recognin 7 (putative)
UBR7
IgG
Affinity Purified
48 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit