Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBR7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | UBR7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154339
|
Novus Biologicals
NBP154339 |
100 μL |
Each for $436.00
|
|
NBP15433920
|
Novus Biologicals
NBP15433920UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
UBR7 Polyclonal specifically detects UBR7 in Human samples. It is validated for Western Blot.Specifications
| UBR7 | |
| Polyclonal | |
| Rabbit | |
| Q8N806 | |
| 55148 | |
| Synthetic peptides corresponding to C14ORF130 The peptide sequence was selected from the N terminal of C14ORF130. Peptide sequence MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C14orf130, chromosome 14 open reading frame 130, EC 6.3.2.-, FLJ10483, MGC9518, N-recognin-7, putative E3 ubiquitin-protein ligase UBR7, ubiquitin protein ligase E3 component n-recognin 7 (putative) | |
| UBR7 | |
| IgG | |
| Affinity Purified | |
| 48 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title