Invitrogen™ UCP2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580203

Catalog No. PIPA580203

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, rat cardiac muscle tissue, rat brain tissue, mouse spleen tissue, mouse cardiac muscle tissue, mouse brain tissue, human Hela whole cell.

UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. UCP2 gene is expressed in many tissues, with the greatest expression in skeletal muscle. UCP2 is thought to play a role in non shivering thermogenesis, obesity and diabetes.

Specifications

• Antigen: UCP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Ucp2
• Gene Alias: BMIQ4; Mitochondrial uncoupling protein 2; Slc25a8; Solute carrier family 25 member 8; UCP 2; Ucp2; UCPH; uncoupling protein; uncoupling protein 2; uncoupling protein 2 (mitochondrial, proton carrier); uncoupling protein 2, mitochondrial
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 22228, 54315, 7351
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P55851, P56500, P70406
• Gene Symbols: Ucp2
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov