Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    UCP4 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257763
Description
UCP4 Polyclonal specifically detects UCP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| UCP4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| FLJ33552, mitochondrial uncoupling protein 4, Solute carrier family 25 member 27, solute carrier family 25, member 27, UCP 4, UCP4uncoupling protein 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9481 | |
| Human | |
| IgG | 
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SLC25A27 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction