UCP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP159598

Catalog No. NBP159598

Description

UCP5 Polyclonal specifically detects UCP5 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: UCP5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BMCP-1, BMCP1UCP 5, brain mitochondrial carrier protein 1, Mitochondrial uncoupling protein 5, solute carrier family 25 (mitochondrial carrier, brain), member 14, Solute carrier family 25 member 14, UCP5MGC149543
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: Q5JY88
• Gene Symbols: SLC25A14
• Immunogen: Synthetic peptides corresponding to SLC25A14(solute carrier family 25 (mitochondrial carrier, brain), member 14) The peptide sequence was selected from the N terminal of SLC25A14 (CAI42439). Peptide sequence SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9016
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
• Form: Purified

For Research Use Only