Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uev1a/UBE2V1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Uev1a/UBE2V1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Uev1a/UBE2V1 Polyclonal specifically detects Uev1a/UBE2V1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Uev1a/UBE2V1 | |
Polyclonal | |
Rabbit | |
Human | |
7335 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
CROC1TRAF6-regulated IKK activator 1 beta Uev1A, CROC-1UBE2V, ubiquitin-conjugating enzyme E2 variant 1, UEV1A, UEV-1CIR1, UEV1DNA-binding protein | |
UBE2V1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title