Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UFD1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP321251100UL
Description
UFD1L Polyclonal antibody specifically detects UFD1L in Human samples. It is validated for ImmunofluorescenceSpecifications
UFD1L | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
ATP1C, ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide, FXYD domain containing ion transport regulator 2, FXYD domain-containing ion transport regulator 2, HOMG2, hypomagnesemia 2, renal, MGC12372, Na(+)/K(+) ATPase subunit gamma, Sodium pump gamma chain, sodium/potassium-transporting ATPase subunit gamma, Sodium-potassium-ATPase, gamma polypeptide | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR | |
100 μg | |
Primary | |
Human | |
Purified |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
7353 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction