Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UFL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $499.50

Specifications

Antigen	UFL1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15543820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15543820UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155438 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155438	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

UFL1 Polyclonal specifically detects UFL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	UFL1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	O94874
Gene ID (Entrez)	23376
Immunogen	Synthetic peptide directed towards the middle region of human UFL1 Peptide sequence: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	E3 UFM1-protein ligase 1, EC 6.3.2.-, KIAA0776, LZAP-binding protein, NLBPnovel LZAP-binding protein, RP3-393D12.1, UFL1
Gene Symbols	UFL1
Isotype	IgG
Molecular Weight of Antigen	89 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

UFL1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents