Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UFM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | UFM1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
UFM1 Polyclonal specifically detects UFM1 in Human samples. It is validated for Western Blot.Specifications
UFM1 | |
Polyclonal | |
Rabbit | |
NP_057701 | |
51569 | |
Synthetic peptide directed towards the middle region of human UFM1The immunogen for this antibody is UFM1. Peptide sequence LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
bA131P10.1, BM-002, C13orf20, chromosome 13 open reading frame 20, ubiquitin-fold modifier 1 | |
UFM1 | |
IgG | |
9 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title