UGCG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162512

Catalog No. NBP162512

Description

UGCG Polyclonal specifically detects UGCG in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UGCG
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ceramide glucosyltransferase, EC 2.4.1.80, GCSGLCT1, GLCT-1, Glucosylceramide synthase, UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Yeast: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q16739
• Gene Symbols: UGCG
• Immunogen: Synthetic peptides corresponding to UGCG(UDP-glucose ceramide glucosyltransferase) The peptide sequence was selected from the N terminal of human UGCG. Peptide sequence LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7357
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only