UGCGL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179299

Catalog No. NBP179299

Description

UGCGL2 Polyclonal specifically detects UGCGL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UGCGL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ10873, HUGT2, MGC117360, UDP-Glc:glycoprotein glucosyltransferase 2, UDP-glucose ceramide glucosyltransferase-like 1, UDP-glucose glycoprotein glucosyltransferase 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55757
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_064506
• Gene Symbols: UGGT2
• Immunogen: Synthetic peptide directed towards the N terminal of human UGCGL2The immunogen for this antibody is UGCGL2. Peptide sequence KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Chicken: 78%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG