Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UGCGL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | UGCGL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17929920
|
Novus Biologicals
NBP17929920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179299
|
Novus Biologicals
NBP179299 |
100 μL |
Each for $487.50
|
|
|||||
Description
UGCGL2 Polyclonal specifically detects UGCGL2 in Human samples. It is validated for Western Blot.Specifications
| UGCGL2 | |
| Polyclonal | |
| Rabbit | |
| NP_064506 | |
| 55757 | |
| Synthetic peptide directed towards the N terminal of human UGCGL2The immunogen for this antibody is UGCGL2. Peptide sequence KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ10873, HUGT2, MGC117360, UDP-Glc:glycoprotein glucosyltransferase 2, UDP-glucose ceramide glucosyltransferase-like 1, UDP-glucose glycoprotein glucosyltransferase 2 | |
| UGGT2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title