Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UGT Antibody, Novus Biologicals™
SDP

Catalog No. NBP180642 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180642 0.1 mL
NB434142 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP180642 Supplier Novus Biologicals Supplier No. NBP180642
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UGT Polyclonal specifically detects UGT in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen UGT
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P78381
Gene Alias solute carrier family 35 (UDP-galactose transporter), member 2, solute carrier family 35 (UDP-galactose transporter), member A2, UDP-galactose translocator, UGALTUGAT, UGT1, UGT2UDP-galactose transporter, UGTLSolute carrier family 35 member A2, UGTUDP-Gal-Tr
Gene Symbols SLC35A2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7355
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.