UGT2A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169358

Catalog No. NBP169358

Description

UGT2A3 Polyclonal antibody specifically detects UGT2A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UGT2A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.17, FLJ21934, UDP glucuronosyltransferase 2 family, polypeptide A3, UDP-glucuronosyltransferase 2A3, UDPGT 2A3
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 79799
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6UWM9
• Gene Symbols: UGT2A3
• Immunogen: Synthetic peptides corresponding to UGT2A3(UDP glucuronosyltransferase 2 family, polypeptide A3) The peptide sequence was selected from the middle region of UGT2A3. Peptide sequence GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 79%.
• Target Species: Human, Mouse, Canine
• Isotype: IgG

For Research Use Only