Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UGT3A2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169421 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169421 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169421 Supplier Novus Biologicals Supplier No. NBP169421
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UGT3A2 Polyclonal specifically detects UGT3A2 in Human samples. It is validated for Western Blot.

Specifications

Antigen UGT3A2
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q3SY77
Gene Alias EC 2.4.1.17, MGC119426, MGC119429, UDP glycosyltransferase 3 family, polypeptide A2, UDP-glucuronosyltransferase 3A2, UDPGT 3A2
Gene Symbols UGT3A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UGT3A2(UDP glycosyltransferase 3 family, polypeptide A2) The peptide sequence was selected from the N terminal of UGT3A2. Peptide sequence HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET.
Molecular Weight of Antigen 59 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 167127
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.