UGT3A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169421

Catalog No. NBP169421

Description

UGT3A2 Polyclonal specifically detects UGT3A2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UGT3A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.17, MGC119426, MGC119429, UDP glycosyltransferase 3 family, polypeptide A2, UDP-glucuronosyltransferase 3A2, UDPGT 3A2
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 167127
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q3SY77
• Gene Symbols: UGT3A2
• Immunogen: Synthetic peptides corresponding to UGT3A2(UDP glycosyltransferase 3 family, polypeptide A2) The peptide sequence was selected from the N terminal of UGT3A2. Peptide sequence HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only