Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UNC45A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | UNC45A |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154882
|
Novus Biologicals
NBP154882 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
UNC45A Polyclonal specifically detects UNC45A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| UNC45A | |
| Unconjugated | |
| RUO | |
| FLJ10043, GCUNC45, GC-UNC45, GCUNC-45, general cell UNC45, protein unc-45 homolog A, SMAP-1IRO039700, SMAP1UNC-45A, smooth muscle cell associated protein-1, Smooth muscle cell-associated protein 1, unc-45 homolog A (C. elegans), Unc-45A | |
| UNC45A | |
| IgG | |
| 102 kDa |
| Polyclonal | |
| Rabbit | |
| A8K6F7 | |
| 55898 | |
| Synthetic peptides corresponding to UNC45A(unc-45 homolog A (C. elegans)) The peptide sequence was selected from the middle region of UNC45A. Peptide sequence REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title