Learn More
Invitrogen™ UNC5C Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA595332
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, HELA whole cell. Flow: SH-SY5Y cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin -like domains and 2 type I thrombospondin motifs in the extracellular region.
Specifications
UNC5C | |
Polyclonal | |
Unconjugated | |
Unc5c | |
B130051O18Rik; Netrin receptor UNC5C; protein unc-5 homolog 3; Protein unc-5 homolog C; Rcm; Rostral cerebellar malformation protein; unc5 (C.elegans homolog) c; unc5 homolog 3; UNC-5 homolog 3; unc-5 homolog C; unc-5 homolog C (C. elegans); unc-5 netrin receptor C; UNC5C; UNC5H3 | |
Rabbit | |
Affinity chromatography | |
RUO | |
22253, 362049, 8633 | |
-20°C | |
Lyophilized |
Flow Cytometry, Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.01mg sodium azide | |
O08747, O95185, Q761X5 | |
Unc5c | |
A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.