Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UNC93B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | UNC93B |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
UNC93B Polyclonal specifically detects UNC93B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
UNC93B | |
Polyclonal | |
Rabbit | |
Human | |
81622 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
hUNC93B1, MGC126617, unc93 (C. elegans) homolog B1, unc93 homolog B, unc93 homolog B1, unc-93 homolog B1 (C. elegans), unc-93 related protein, UNC93B, Unc-93B1, UNC93protein unc-93 homolog B1 | |
UNC93B1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title