Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UNK Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 2 publications

$382.00 - $646.00

Specifications

Antigen UNK
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB430577
SDP
View Documents
Novus Biologicals
NBP18959625UL
25 μL
Each for $382.00
Only null left
Add to Cart
 
NBP189596
SDP
View Documents
Novus Biologicals
NBP189596
0.1 mL
Each for $646.00
Only null left
Add to Cart
 
Description

Description

UNK Polyclonal specifically detects UNK in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications

Specifications

UNK
Polyclonal
Rabbit
Human, Mouse
Q9C0B0
85451
This antibody was developed against Recombinant Protein corresponding to amino acids:DAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL
Primary
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Unconjugated
RUO
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
UNK unkempt homolog (Drosophila), ZC3H5, ZC3HDC5
UNK
IgG
Affinity Purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Videos
SDS
Documents

Documents

Product Certifications

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.