Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UNKL Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310569100UL
Description
UNKL Polyclonal specifically detects UNKL in Mouse samples. It is validated for Western Blot.Specifications
UNKL | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C16orf28, chromosome 16 open reading frame 28, EC 6.3.2.-, FLJ12623, KIAA0734, Putative E3 ubiquitin-protein ligase UNKL, RING finger protein unkempt-like, unkempt homolog (Drosophila)-like, unkempt-like, ZC3H5LMGC5179, ZC3HDC5LFLJ23360 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse UNKL (NP_083065). Peptide sequence IASLDKDLEEQDLGLTGLNGVPGSIWDFVSGSFSPSPSPILNSGPSASSS | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
64718 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction