Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580208

Invitrogen™ UPF1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580208
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580208 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580208 Supplier Invitrogen™ Supplier No. PA580208
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human Raji whole cell, human HepG2 whole cell, human SK-OV-3 whole cell, human PC-3 whole cell, human HEK293 whole cell, rat RH35 whole cell, mouse HEPA1-6 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. ICC/IF: A431 cell. Flow: PC-3 cell.

Upf1 was identified as an active component in nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons. Upf1 was found to be an ATP-dependent RNA helicase in the cytoplasm and was later shown to be a component of cytoplasmic P-bodies. Upf1 phosphorylation mediates the repression of translation that accompanies NMD, allowing mRNA accessibility to the NMD machinery. Two other active components of NMD, Upf2 and Upf3, were also identified and described as having perinuclear and nucleocytoplasmic localization, respectively.
TRUSTED_SUSTAINABILITY

Specifications

Antigen UPF1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene UPF1
Gene Accession No. Q92900, Q9EPU0
Gene Alias ATP-dependent helicase RENT1; B430202H16Rik; delta helicase; FLJ43809; FLJ46894; HUPF1; KIAA0221; LOW QUALITY PROTEIN: regulator of nonsense transcripts 1; mUpf1; Nonsense mRNA reducing factor 1; NORF1; pNORF1; PNORF-1; Regulator of nonsense transcripts 1; Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog); Rent1; smg-2; smg-2 homolog, nonsense mediated mRNA decay factor; Upf1; UPF1 regulator of nonsense transcripts homolog; UPF1 regulator of nonsense transcripts homolog (yeast); UPF1 RNA helicase and ATPase; UPF1, RNA helicase and ATPase; Upflp; up-frameshift mutation 1 homolog; up-frameshift suppressor 1 homolog; wu:fi40f07; wu:fj48a01; yeast Upf1p homolog; zgc:55472
Gene Symbols UPF1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 19704, 5976, 684558
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.