Invitrogen™ UPF3B Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580209

Catalog No. PIPA580209

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human 22RV1 whole cell, human U87 whole cell, human Jurkat whole cell, rat brain tissue. IHC: mouse testis tissue, rat testis tissue, human placenta tissue.

UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: UPF3B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: UPF3B
• Gene Alias: 5730594O13Rik; AI317193; AW541158; HUPF3B; hUpf3p-X; mental retardation, X-linked 62; MRX62; MRXS14; Nonsense mRNA reducing factor 3B; regulator of nonsense transcripts 3B; RENT3B; RGD1560264; Unknown (protein for MGC:134301); UPF3 regulator of nonsense transcripts homolog B; UPF3 regulator of nonsense transcripts homolog B (yeast); UPF3 regulator of nonsense transcripts-like protein B; UPF3B; UPF3B pseudogene 1; UPF3B pseudogene 2; UPF3B pseudogene 3; UPF3B regulator of nonsense mediated mRNA decay; UPF3BP1; UPF3BP2; UPF3BP3; Upf3p-X; UPF3X; up-frameshift suppressor 3 homolog B; Up-frameshift suppressor 3 homolog on chromosome X
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 313449, 65109, 68134
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q9BZI7
• Gene Symbols: UPF3B
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B /RENT3B (416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG