Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
URI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | URI |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
URI Polyclonal specifically detects URI in Human samples. It is validated for Western Blot.Specifications
URI | |
Polyclonal | |
Rabbit | |
chromosome 19 open reading frame 2, FLJ10575, NNX3RPB5-mediating protein, Protein NNX3, RMPunconventional prefoldin RPB5 interactor, RNA polymerase II subunit 5-mediating protein, URIRNA polymerase II, subunit 5-mediating protein | |
URI1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
8725 | |
Synthetic peptide directed towards the middle region of human C19orf2. Peptide sequence NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title