Uridine Phosphorylase 1/UPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155354

Catalog No. NBP155354

Description

Uridine Phosphorylase 1/UPP1 Polyclonal specifically detects Uridine Phosphorylase 1/UPP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Uridine Phosphorylase 1/UPP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 75%; Guinea pig: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q16831
• Gene Symbols: UPP1
• Immunogen: Synthetic peptide directed towards the N terminal of human UPP1(NP_003355). Peptide sequence AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7378
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.