Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uridine Phosphorylase 1/UPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15535420UL
Description
Uridine Phosphorylase 1/UPP1 Polyclonal specifically detects Uridine Phosphorylase 1/UPP1 in Human samples. It is validated for Western Blot.Specifications
Uridine Phosphorylase 1/UPP1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q16831 | |
UPP1 | |
Synthetic peptide directed towards the N terminal of human UPP1(NP_003355). Peptide sequence AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG. | |
Affinity Purified | |
RUO | |
7378 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1 | |
Rabbit | |
34 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction