Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uridine Phosphorylase 1/UPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Uridine Phosphorylase 1/UPP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15535520
![]() |
Novus Biologicals
NBP15535520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP155355
![]() |
Novus Biologicals
NBP155355 |
100 μL |
Each for $487.50
|
|
|||||
Description
Uridine Phosphorylase 1/UPP1 Polyclonal specifically detects Uridine Phosphorylase 1/UPP1 in Human samples. It is validated for Western Blot.Specifications
Uridine Phosphorylase 1/UPP1 | |
Polyclonal | |
Rabbit | |
Q16831 | |
7378 | |
Synthetic peptides corresponding to UPP1(uridine phosphorylase 1) The peptide sequence was selected from the middle region of UPP1. Peptide sequence ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1 | |
UPP1 | |
IgG | |
34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title