Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uridine Phosphorylase 1/UPP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Uridine Phosphorylase 1/UPP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15535520
|
Novus Biologicals
NBP15535520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155355
|
Novus Biologicals
NBP155355 |
100 μL |
Each for $487.50
|
|
|||||
Description
Uridine Phosphorylase 1/UPP1 Polyclonal specifically detects Uridine Phosphorylase 1/UPP1 in Human samples. It is validated for Western Blot.Specifications
| Uridine Phosphorylase 1/UPP1 | |
| Polyclonal | |
| Rabbit | |
| Q16831 | |
| 7378 | |
| Synthetic peptides corresponding to UPP1(uridine phosphorylase 1) The peptide sequence was selected from the middle region of UPP1. Peptide sequence ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1 | |
| UPP1 | |
| IgG | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title