Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uroguanylin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP286888
Description
Uroguanylin Polyclonal specifically detects Uroguanylin in Human samples. It is validated for Western Blot.Specifications
Uroguanylin | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
2981 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
GCAP-II, guanylate cyclase activator 2B, guanylate cyclase activator 2B (uroguanylin), UGN, uroguanylin | |
The immunogen is a synthetic peptide directed towards the middle region of Human Uroguanylin. Peptide sequence: MKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFK The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction