Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uroplakin IIIB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$416.50 - $682.00
Specifications
| Antigen | Uroplakin IIIB |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Uroplakin IIIB Polyclonal specifically detects Uroplakin IIIB in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Uroplakin IIIB | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 105375355 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| FLJ32198, MGC10902, p35, UP3b, UPIIIB, UPIIIbP35, uroplakin 3B, Uroplakin IIIb, uroplakin-3b | |
| UPK3B | |
| IgG | |
| Affinity Purified | |
| Specificity of human Uroplakin IIIB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title