USP11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180639

Catalog No. NBP180639

Description

USP11 Polyclonal specifically detects USP11 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: USP11
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P51784, P51784, P51784, P51784
• Gene Symbols: USP11
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNT
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 11, EC 3.1.2.15, EC 3.4.19.12, ubiquitin carboxyl-terminal hydrolase 11, ubiquitin specific peptidase 11, ubiquitin specific protease 11, ubiquitin thioesterase 11, Ubiquitin thiolesterase 11, ubiquitin-specific processing protease 11, Ubiquitin-specific-processing protease 11, UHX1ubiquitin carboxyl-terminal hydrolase, X-linked
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8237
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only