Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. USP16 Antibody, Novus Biologicals™

USP16 Antibody, Novus Biologicals™
SDP

Catalog No. NB431627 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB431627 25 μL
NBP186881 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB431627 Supplier Novus Biologicals Supplier No. NBP18688125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

USP16 Polyclonal specifically detects USP16 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen USP16
Applications Immunofluorescence, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Deubiquitinating enzyme 16, EC 3.1.2.15, EC 3.4.19.12, human ubiquitin processing protease, EC 3.1.2.1510ubiquitin specific protease 16, ubiquitin carboxyl-terminal hydrolase 16, ubiquitin specific peptidase 16, ubiquitin thioesterase 16, Ubiquitin thiolesterase 16, Ubiquitin-processing protease UBP-M, ubiquitin-specific processing protease 16, Ubiquitin-specific-processing protease 16, UBP-M
Gene Symbols USP16
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKM
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 10600
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.