USP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169153

Catalog No. NBP169153

Description

USP2 Polyclonal specifically detects USP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: USP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 2, EC 3.1.2.15, EC 3.4.19.12,41 kDa ubiquitin-specific protease, ubiquitin specific peptidase 2, ubiquitin specific protease 12, ubiquitin specific protease 2, ubiquitin specific protease 9, ubiquitin thioesterase 2, Ubiquitin thiolesterase 2, Ubiquitin-specific-processing protease 2, UBP41ubiquitin carboxyl-terminal hydrolase 2, USP9
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Horse: 86%; Mouse: 83%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75604
• Gene Symbols: USP2
• Immunogen: Synthetic peptides corresponding to USP2 (ubiquitin specific peptidase 2) The peptide sequence was selected from the N terminal of USP2. Peptide sequence LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9099
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.