USP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16915320UL

Catalog No. NBP16915320

Description

USP2 Polyclonal specifically detects USP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: USP2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: O75604
• Gene Symbols: USP2
• Immunogen: Synthetic peptides corresponding to USP2 (ubiquitin specific peptidase 2) The peptide sequence was selected from the N terminal of USP2. Peptide sequence LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9099
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 2, EC 3.1.2.15, EC 3.4.19.12,41 kDa ubiquitin-specific protease, ubiquitin specific peptidase 2, ubiquitin specific protease 12, ubiquitin specific protease 2, ubiquitin specific protease 9, ubiquitin thioesterase 2, Ubiquitin thiolesterase 2, Ubiquitin-specific-processing protease 2, UBP41ubiquitin carboxyl-terminal hydrolase 2, USP9
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG