Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. USP2 Antibody, Novus Biologicals™

USP2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16915320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16915320 20 μL
NBP169153 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16915320 Supplier Novus Biologicals Supplier No. NBP16915320UL

Description

Rabbit Polyclonal Antibody

USP2 Polyclonal specifically detects USP2 in Human samples. It is validated for Western Blot.

Specifications

Antigen USP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O75604
Gene Alias Deubiquitinating enzyme 2, EC 3.1.2.15, EC 3.4.19.12,41 kDa ubiquitin-specific protease, ubiquitin specific peptidase 2, ubiquitin specific protease 12, ubiquitin specific protease 2, ubiquitin specific protease 9, ubiquitin thioesterase 2, Ubiquitin thiolesterase 2, Ubiquitin-specific-processing protease 2, UBP41ubiquitin carboxyl-terminal hydrolase 2, USP9
Gene Symbols USP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to USP2 (ubiquitin specific peptidase 2) The peptide sequence was selected from the N terminal of USP2. Peptide sequence LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN.
Molecular Weight of Antigen 68 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9099
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.