Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
USP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | USP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16915320
|
Novus Biologicals
NBP16915320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169153
|
Novus Biologicals
NBP169153 |
100 μL |
Each for $487.50
|
|
|||||
Description
USP2 Polyclonal specifically detects USP2 in Human samples. It is validated for Western Blot.Specifications
| USP2 | |
| Polyclonal | |
| Rabbit | |
| O75604 | |
| 9099 | |
| Synthetic peptides corresponding to USP2 (ubiquitin specific peptidase 2) The peptide sequence was selected from the N terminal of USP2. Peptide sequence LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Deubiquitinating enzyme 2, EC 3.1.2.15, EC 3.4.19.12,41 kDa ubiquitin-specific protease, ubiquitin specific peptidase 2, ubiquitin specific protease 12, ubiquitin specific protease 2, ubiquitin specific protease 9, ubiquitin thioesterase 2, Ubiquitin thiolesterase 2, Ubiquitin-specific-processing protease 2, UBP41ubiquitin carboxyl-terminal hydrolase 2, USP9 | |
| USP2 | |
| IgG | |
| 68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title