Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
USP22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | USP22 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
USP22 Polyclonal specifically detects USP22 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| USP22 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Signal Transduction, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Deubiquitinating enzyme 22, EC 3.1.2.15, EC 3.4.19.12, KIAA1063ubiquitin carboxyl-terminal hydrolase 22, KIAA1064, ubiquitin specific peptidase 22, ubiquitin specific peptidase 3-like, ubiquitin specific protease 22, ubiquitin thioesterase 22, Ubiquitin thiolesterase 22, ubiquitin-specific processing protease 22, Ubiquitin-specific-processing protease 22, USP3L | |
| USP22 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9UPT9 | |
| 23326 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 60 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title