USP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179748

Catalog No. NBP179748

Description

USP29 Polyclonal specifically detects USP29 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: USP29
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 29, EC 3.1.2.15, EC 3.4.19.12, HOM-TES-84/86, MGC163266, MGC163270, ubiquitin carboxyl-terminal hydrolase 29, ubiquitin specific peptidase 29, ubiquitin specific protease 29, ubiquitin thioesterase 29, Ubiquitin thiolesterase 29, ubiquitin-specific processing protease, Ubiquitin-specific-processing protease 29
• Host Species: Rabbit
• Molecular Weight of Antigen: 104 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_065954
• Gene Symbols: USP29
• Immunogen: Synthetic peptide directed towards the N terminal of human USP29The immunogen for this antibody is USP29. Peptide sequence EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57663
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.