UST Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160042

Catalog No. NBP160042

Description

UST Polyclonal specifically detects UST in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UST
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2OST, dermatan/chondroitin sulfate 2-sulfotransferase, DS2ST, EC 2.8.2.-, uronyl 2-sulfotransferase, uronyl-2-sulfotransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: Q9Y2C2
• Gene Symbols: UST
• Immunogen: Synthetic peptide directed towards the C terminal of human UST (NP_005706). Peptide sequence YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10090
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG