UTP11L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192567

Catalog No. NBP192567

Description

UTP11L Polyclonal specifically detects UTP11L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UTP11L
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CGI94, CGI-94, probable U3 small nucleolar RNA-associated protein 11, U3 snoRNA-associated protein 11, UTP11-like protein, UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: UTP11L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication, Cytokine Research
• Gene ID (Entrez): 51118
• Target Species: Human
• Isotype: IgG

For Research Use Only