Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UTP11L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$106.19 - $352.89
Specifications
| Antigen | UTP11L |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Format | Purified |
Description
UTP11L Polyclonal specifically detects UTP11L in Human samples. It is validated for Western Blot.Specifications
| UTP11L | |
| Western Blot | |
| Purified | |
| RUO | |
| Human | |
| CGI94, CGI-94, probable U3 small nucleolar RNA-associated protein 11, U3 snoRNA-associated protein 11, UTP11-like protein, UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast) | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human UTP11LL (NP_057121). Peptide sequence AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Cytokine Research | |
| PBS buffer, 2% sucrose | |
| 51118 | |
| Polyclonal | |
| Affinity purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title