UTP14A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156964

Catalog No. NBP156964

Description

UTP14A Polyclonal specifically detects UTP14A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UTP14A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Antigen NY-CO-16, dJ537K23.3, FLJ37089, NYCO16, NY-CO-16, SDCCAG16, Serologically defined colon cancer antigen 16KIAA0266, U3 small nucleolar RNA-associated protein 14 homolog A, UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10813
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BVJ6
• Gene Symbols: UTP14A
• Immunogen: Synthetic peptides corresponding to UTP14A (UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)) The peptide sequence was selected from the N terminal of UTP14A. Peptide sequence KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Equine: 92%; Chicken: 84%; Canine: 78%; Mouse: 78%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG