Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UXT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | UXT |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP154826
|
Novus Biologicals
NBP154826 |
100 μL |
Each for $436.00
|
|
NBP15482620
|
Novus Biologicals
NBP15482620UL |
20 μL |
Each for $152.22
|
|
Description
UXT Polyclonal specifically detects UXT in Human samples. It is validated for Western Blot.Specifications
UXT | |
Polyclonal | |
Purified | |
RUO | |
Q9UBK9 | |
8409 | |
Synthetic peptides corresponding to UXT(ubiquitously-expressed transcript) The peptide sequence was selected from the N terminal of UXT. Peptide sequence MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Androgen receptor trapped clone 27 protein, ART-27protein UXT, SKP2-associated alpha PFD 1, STAP1, Ubiquitously expressed transcript protein, ubiquitously-expressed transcript | |
UXT | |
IgG | |
Protein A purified | |
18 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title