Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRYGS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CRYGS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CRYGS Polyclonal specifically detects CRYGS in Rat samples. It is validated for Western Blot.Specifications
CRYGS | |
Polyclonal | |
Rabbit | |
NP_001103023 | |
1427 | |
The immunogen for this antibody is Crygs - C-terminal region. Peptide sequence: SCKVLEGTWIFYELPSYHGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
beta-crystallin S, CRYG8, crystallin, gamma 8, crystallin, gamma S, Gamma-crystallin S, gamma-S-crystallin, GRYG8 | |
CRYGS | |
IgG | |
19 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title