MSANTD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198441

Catalog No. NBP198441

Description

MSANTD3 Polyclonal specifically detects MSANTD3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MSANTD3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_542386
• Gene Symbols: MSANTD3
• Immunogen: The immunogen for this antibody is C9orf30 - C-terminal region. Peptide sequence VRITANKNYRSKTSQEGALKKMHEEEHHQQMSILQLQLIQMNEVHVAKIQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91283
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG