DUSP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198449

Catalog No. NBP198449

Description

DUSP4 Polyclonal specifically detects DUSP4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DUSP4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dual specificity phosphatase 4, Dual specificity protein phosphatase hVH2, EC 3.1.3.16, EC 3.1.3.48, HVH2serine/threonine specific protein phosphatase, MAP kinase phosphatase 2, Mitogen-activated protein kinase phosphatase 2, MKP-2dual specificity protein phosphatase 4, MKP2VH1 homologous phosphatase 2, TYP, VH2
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 1846
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001385
• Gene Symbols: DUSP4
• Immunogen: The immunogen for this antibody is DUSP4 - N-terminal region. Peptide sequence RAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.